| Characteristics | |||||||
| Molecular Formula | C46H65N11O10 | ||||||
| CAS Number | 221230-86-5 | ||||||
| Molar Mass | 960.11 g/mol | ||||||
| Amino Acid Sequence | GVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQLLSLFEL | ||||||
| Synonyms | AOD-9604, Anti-obesity peptide, Fragment 177-191 (GH-1) | ||||||
| Solubilit | Soluble in Water | ||||||
| rganoleptic Profile | White powder | ||||||
| Composition | Lyophilized powder – requires reconstitution | ||||||
Product Introduction:
AOD-9604 has shown promise in stimulating lipolysis—the breakdown of stored triglycerides into free fatty acids—and inhibiting lipogenesis, the process of converting excess nutrients into new fat deposits ³. Unlike full-length HGH, early research suggests it may exert these metabolic effects without significantly stimulating insulin-like growth factor 1 (IGF-1) production or disrupting glucose homeostasis ⁴.
Beyond lipid metabolism, AOD-9604 has been explored for its potential role in cartilage and joint research. Studies indicate it may support chondrocyte activity and help maintain proteoglycan and collagen levels in articular cartilage, making it a subject of interest for osteoarthritis and connective tissue regeneration investigations ⁵.
- How does AOD-9604 work?
AOD-9604 exerts its effects through several interconnected mechanisms:
GH Receptor Modulation: AOD-9604 is a synthetic fragment of human growth hormone (HGH, residues 177-191) that targets growth hormone receptors in adipose tissue, without activating systemic IGF-1 signaling pathways. This targeted action initiates intracellular signaling cascades focused on lipid metabolism.
Lipolytic Activation: In fat cells, AOD-9604 enhances triglyceride breakdown (lipolysis) by increasing cyclic AMP (cAMP) levels and activating hormone-sensitive lipase, while simultaneously inhibiting new fat synthesis (lipogenesis).
Cartilage & Tissue Support: AOD-9604 acts on chondrocytes and connective tissue cells, supporting proteoglycan and collagen synthesis in articular cartilage, without the systemic growth effects of full-length HGH.
- Research
Lipid Metabolism & Weight Management: AOD-9604 stimulates targeted fat breakdown in adipose tissue, with preclinical research showing significant reductions in body fat mass without altering lean muscle mass or systemic IGF-1 levels.
Joint & Cartilage Health: Research indicates AOD-9604 may support chondrocyte viability and cartilage regeneration, making it a subject of study for osteoarthritis and connective tissue injury research.
Metabolic Homeostasis: Unlike full HGH, AOD-9604 does not disrupt glucose homeostasis or insulin sensitivity, making it a focused tool for metabolic research.
Musculoskeletal Recovery: Early studies suggest AOD-9604 may support soft tissue repair and reduce inflammation in musculoskeletal injuries, without systemic growth hormone side effects.
- Side Effects
The most common side effects associated with AOD-9604 include:
Mild gastrointestinal discomfort
Headache
Local injection site reaction
Fatigue
Mild joint pain
- Summary
AOD-9604 represents a significant advancement in targeted metabolic and musculoskeletal research, offering a potent tool for investigating lipid metabolism, cartilage health, and tissue repair. Its demonstrated efficacy in targeted fat reduction, cartilage support, and lack of systemic IGF-1 activation makes it a valuable subject for ongoing research in obesity, osteoarthritis, and musculoskeletal injury. As investigations continue, AOD-9604 may provide insights into novel therapeutic strategies for addressing metabolic and musculoskeletal disorders.
- Resource
All products on this site are for research and development use only. Products are not for human consumption of any kind. The statements made on this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure, or prevent any disease. Power Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic Act. Power Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic Act. All products are sold for research, laboratory, or analytical purposes only, and are not for human consumption. Power Peptides Products are intended strictly for research purposes only. These products are not approved by the US Food and Drug Administration (FDA) for human consumption or medical use. Under no circumstances should these peptides be used for any purpose other than research. By purchasing or using our peptides, you acknowledge and agree that you will use them solely in accordance with applicable laws and regulations and that you accept full responsibility for their use. Statements made on this website have not been evaluated by the USA Food and Drug Administration.












Reviews
There are no reviews yet.