| Characteristics | |||||||
| Molecular Formula | C₁₉₉H₃₀₈N₅₆O₅₁S | ||||||
| CAS Number | 946870-92-4 | ||||||
| Molar Mass | 4409.07 g/mol | ||||||
| Amino Acid Sequence | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA | ||||||
| Synonyms | IGF-1 LR3, Long R3 Insulin-like Growth Factor-1, rhIGF-1 LR3, Recombinant IGF-1 LR3, Insulin-like Growth Factor 1 Long Arg3 | ||||||
| Solubilit | Soluble in Water & Aqueous Buffers | ||||||
| rganoleptic Profile | White to Off-White Lyophilized Powder | ||||||
| Composition | Lyophilized powder – requires reconstitution | ||||||
Product Introduction:
IGF-1 LR3 is a long-acting synthetic analog of human insulin-like growth factor 1, engineered with an arginine substitution at position 3 and an extended N-terminal sequence for enhanced stability and bioactivity. This highly potent, water-soluble peptide has been extensively researched for its ability to support muscle growth, cellular repair, and overall anabolic function. IGF-1 LR3 demonstrates exceptional efficacy in promoting muscle hypertrophy, increasing lean body mass, and accelerating post-workout recovery by stimulating protein synthesis and cell proliferation. It may also exhibit anti-catabolic properties, support fat metabolism, and enhance tissue regeneration. IGF-1 LR3 has been studied for its potential to aid in athletic performance enhancement, muscle injury recovery, and body composition optimization. Requires reconstitution before use
- How does IGF-1 LR3 work?
IGF-1 LR3 exerts its effects through several interconnected mechanisms:
IGF-1 Receptor Activation: IGF-1 LR3 binds to and activates insulin-like growth factor 1 (IGF-1) receptors, which are widely expressed in skeletal muscle, liver, adipose tissue, and the central nervous system. This activation initiates potent intracellular signaling cascades, primarily through the PI3K/Akt and MAPK pathways.
Enhanced Stability & Bioavailability: The arginine substitution at position 3 and extended N-terminal sequence significantly reduce binding to IGF-binding proteins (IGFBPs), prolonging circulation half-life and increasing bioactivity compared to native IGF-1.
Anabolic Signaling: By activating IGF-1 receptors in muscle cells, IGF-1 LR3 stimulates robust protein synthesis, inhibits protein breakdown, and promotes satellite cell proliferation, driving muscle hypertrophy and repair.
- Research
Muscle Growth & Hypertrophy: Studies demonstrate IGF-1 LR3’s ability to increase lean body mass, enhance muscle fiber growth, and accelerate post-exercise recovery by boosting cellular anabolism.
Metabolic Effects: Research indicates IGF-1 LR3 supports fat metabolism, promotes lipolysis in adipose tissue, and may improve insulin sensitivity in muscle cells.
Tissue Regeneration: Preclinical research shows potential for accelerating wound healing, tendon/ligament repair, and recovery from muscle injuries.
Performance Enhancement: Investigated for its ability to enhance athletic performance, reduce recovery time, and support body composition optimization in research settings.
- Side Effects
The most common side effects associated with IGF-1 LR3 include:
– Hypoglycemia (low blood sugar)
– Joint pain
– Edema (fluid retention)
– Numbness or tingling in extremities
– Increased risk of insulin resistance with prolonged use
– Headache
- Summary
IGF-1 LR3 represents a significant advancement in anabolic peptide research, offering a long-acting, highly potent analog of native IGF-1 with enhanced bioavailability and anabolic efficacy. Its demonstrated potential in promoting muscle growth, accelerating tissue repair, and supporting metabolic health makes it a valuable subject for ongoing research in sports science, regenerative medicine, and metabolic physiology. As investigations continue, IGF-1 LR3 may provide insights into novel strategies for addressing muscle wasting, injury recovery, and body composition optimization.
- Resource
All products on this site are for research and development use only. Products are not for human consumption of any kind. The statements made on this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure, or prevent any disease. Power Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic Act. Power Peptides is not our outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic Act. All products are sold for research, laboratory, or analytical purposes only, and are not for human consumption. Power Peptides Products are intended strictly for research purposes only. These products are not approved by the U.S. Food and Drug Administration (FDA) for human consumption or medical use. Under no circumstances should these peptides be used for any purpose other than research. By purchasing or using our peptides, you acknowledge and agree that you will use them solely in accordance with applicable laws and regulations and that you accept full responsibility for their use. Statements made on this website have not been evaluated by the USA Food and Drug Administration.









Reviews
There are no reviews yet.