| Characteristics | |||||||
| Molecular Formula | C₁₅₁H₂₅₅N₄₅O₄₆ | ||||||
| CAS Number | 112568-12-9 | ||||||
| Molar Mass | 3589.9 g/mol | ||||||
| Amino Acid Sequence | YSRTDLKTLVGVAQRLLQDIKETVEMLREAEDLQRKLEEAEKAKAQQHLFQDLIKAKKQQKLEELEKLF | ||||||
| Synonyms | Mechano Growth Factor, MGF, PEG-MGF, Mechano-Growth Factor, 112568-12-9 | ||||||
| Solubilit | Soluble in Water | ||||||
| rganoleptic Profile | White to off-white lyophilized powder | ||||||
| Composition | Lyophilized powder – requires reconstitution | ||||||
Product Introduction:
MGF (Mechano Growth Factor) is a synthetic peptide derived from the insulin-like growth factor 1 (IGF-1) gene, specifically expressed in response to mechanical muscle stress. This highly bioactive, water-soluble peptide has been extensively researched for its potential to support muscle growth, tissue repair, and exercise recovery. MGF has shown promise in promoting satellite cell activation, muscle hypertrophy, and the regeneration of damaged muscle fibers. It may also have neuroprotective and anti-inflammatory properties, supporting overall musculoskeletal health. MGF has been studied for its potential to aid in muscle injury recovery, strength gain, and the maintenance of lean muscle mass. Requires reconstitution before use.
- How does MGF work?
MGF exerts its effects through several interconnected mechanisms:
IGF-1 Receptor & Satellite Cell Activation: MGF binds to and activates IGF-1 receptors, with a unique C-terminal sequence that specifically targets muscle satellite cells—muscle stem cells responsible for muscle growth and repair. This activation initiates intracellular signaling cascades, primarily through the PI3K/Akt and MAPK pathways, driving satellite cell proliferation and differentiation.
Muscle Hypertrophy & Regeneration: In damaged or mechanically stressed muscle fibers, MGF stimulates the fusion of activated satellite cells with existing muscle fibers, increasing muscle fiber size and promoting the regeneration of injured tissue.
Local Tissue Response: Unlike systemic IGF-1, MGF acts locally in muscle tissue in response to mechanical load or injury, making it a key regulator of adaptive muscle growth.
- Research
Muscle Growth & Hypertrophy: MGF has been extensively researched for its ability to promote muscle hypertrophy by activating satellite cells and increasing muscle protein synthesis, making it a focus of studies on muscle development and strength gain.
Muscle Injury Recovery: Research demonstrates MGF’s potential to accelerate the repair of damaged muscle fibers, reduce recovery time from exercise-induced muscle damage, and support the healing of muscle strains and tears.
Sarcopenia & Age-Related Muscle Loss: Studies have investigated MGF’s role in counteracting age-related muscle wasting (sarcopenia) by restoring satellite cell function and promoting muscle growth in older populations.
Musculoskeletal Health: MGF has shown promise in supporting the repair of tendons and ligaments, as well as reducing inflammation in musculoskeletal injuries.
- Side Effects
The most common side effects associated with MGF use include:
• Local injection site reactions (redness, swelling, pain)
• Muscle soreness or cramping
• Temporary fatigue
• Mild joint pain
• Headache
- Summary
MGF represents a significant advancement in muscle growth and tissue repair research, offering a potent tool for investigating the multifaceted roles of local IGF-1 signaling in musculoskeletal physiology. Its demonstrated efficacy in satellite cell activation, muscle hypertrophy, and injury recovery makes it a valuable subject for ongoing research in the treatment of muscle wasting, sports injuries, and age-related musculoskeletal disorders. As investigations continue, MGF may provide insights into novel therapeutic strategies for addressing the global burden of muscle-related conditions and performance optimization.
- Resource
All products on this site are for research and development use only. Products are not for human consumption of any kind. The statements made on this website have not been evaluated by the US Food and Drug Administration. The statements and the products of this company are not intended to diagnose, treat, cure, or prevent any disease. Power Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic Act. Power Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic Act. All products are sold for research, laboratory, or analytical purposes only, and are not for human consumption. Power Peptides Products are intended strictly for research purposes only. These products are not approved by the U.S. Food and Drug Administration (FDA) for human consumption or medical use. Under no circumstances should these peptides be used for any purpose other than research. By purchasing or using our peptides, you acknowledge and agree that you will use them solely in accordance with applicable laws and regulations and that you accept full responsibility for their use. Statements made on this website have not been evaluated by the USA Food and Drug Administration.










Reviews
There are no reviews yet.